Lineage for d2gd1q2 (2gd1 Q:149-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961713Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
  8. 2961752Domain d2gd1q2: 2gd1 Q:149-312 [39895]
    Other proteins in same PDB: d2gd1o1, d2gd1p1, d2gd1q1, d2gd1r1
    complexed with so4

Details for d2gd1q2

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus
PDB Compounds: (Q:) apo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2gd1q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1q2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d2gd1q2:

Click to download the PDB-style file with coordinates for d2gd1q2.
(The format of our PDB-style files is described here.)

Timeline for d2gd1q2: