Lineage for d2gd1p2 (2gd1 P:149-312)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331068Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 331086Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)
  7. 331098Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)
  8. 331132Domain d2gd1p2: 2gd1 P:149-312 [39894]
    Other proteins in same PDB: d2gd1o1, d2gd1p1, d2gd1q1, d2gd1r1

Details for d2gd1p2

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus

SCOP Domain Sequences for d2gd1p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1p2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d2gd1p2:

Click to download the PDB-style file with coordinates for d2gd1p2.
(The format of our PDB-style files is described here.)

Timeline for d2gd1p2: