Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species) |
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries) |
Domain d2gd1o2: 2gd1 O:149-312 [39893] Other proteins in same PDB: d2gd1o1, d2gd1p1, d2gd1q1, d2gd1r1 complexed with so4 |
PDB Entry: 2gd1 (more details), 2.5 Å
SCOPe Domain Sequences for d2gd1o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gd1o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
Timeline for d2gd1o2: