Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.0: automated matches [254324] (1 protein) not a true family |
Protein automated matches [254742] (3 species) not a true protein |
Species Homo sapiens [TaxId:9606] [398916] (1 PDB entry) |
Domain d7d59k_: 7d59 K: [398917] Other proteins in same PDB: d7d59h_, d7d59j_, d7d59l_ automated match to d4c3ik_ complexed with sf4, zn |
PDB Entry: 7d59 (more details), 3.1 Å
SCOPe Domain Sequences for d7d59k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d59k_ d.74.3.0 (K:) automated matches {Homo sapiens [TaxId: 9606]} ktalemvqaagtdrhcvtfvlheedhtlgnslrymimknpevefcgyttthpseskinlr iqtrgtlpavepfqrglnelmnvcqhvldkfeasikdykdqkasrne
Timeline for d7d59k_: