Lineage for d7d59k_ (7d59 K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2565033Family d.74.3.0: automated matches [254324] (1 protein)
    not a true family
  6. 2565034Protein automated matches [254742] (3 species)
    not a true protein
  7. 2565039Species Homo sapiens [TaxId:9606] [398916] (1 PDB entry)
  8. 2565040Domain d7d59k_: 7d59 K: [398917]
    Other proteins in same PDB: d7d59h_, d7d59j_, d7d59l_
    automated match to d4c3ik_
    complexed with sf4, zn

Details for d7d59k_

PDB Entry: 7d59 (more details), 3.1 Å

PDB Description: cryo-em structure of human rna polymerase iii in apo state
PDB Compounds: (K:) DNA-directed RNA polymerases I and III subunit rpac2

SCOPe Domain Sequences for d7d59k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d59k_ d.74.3.0 (K:) automated matches {Homo sapiens [TaxId: 9606]}
ktalemvqaagtdrhcvtfvlheedhtlgnslrymimknpevefcgyttthpseskinlr
iqtrgtlpavepfqrglnelmnvcqhvldkfeasikdykdqkasrne

SCOPe Domain Coordinates for d7d59k_:

Click to download the PDB-style file with coordinates for d7d59k_.
(The format of our PDB-style files is described here.)

Timeline for d7d59k_: