Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries) |
Domain d4dbvq2: 4dbv Q:149-312 [39891] Other proteins in same PDB: d4dbvo1, d4dbvp1, d4dbvq1, d4dbvr1 complexed with ndp, so4; mutant |
PDB Entry: 4dbv (more details), 2.5 Å
SCOPe Domain Sequences for d4dbvq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dbvq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
Timeline for d4dbvq2: