Lineage for d7do7a1 (7do7 A:2-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845961Species Azotobacter vinelandii [TaxId:322710] [398354] (4 PDB entries)
  8. 2845962Domain d7do7a1: 7do7 A:2-256 [398903]
    Other proteins in same PDB: d7do7a2, d7do7b2
    automated match to d4nbua_
    complexed with nad, rm4

Details for d7do7a1

PDB Entry: 7do7 (more details), 1.57 Å

PDB Description: crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(nad and l-rhamnose bound-form)
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d7do7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7do7a1 c.2.1.0 (A:2-256) automated matches {Azotobacter vinelandii [TaxId: 322710]}
llidktvivtgasrgigraaarecarqgarvvighsgsdegragalslaeeiaafggtai
avgadaadldsgeklvaaaveafgsvdvlvnnagicpfhsfldmprelylktvgtnlnga
yftvqaaarrmkeqgrggaiiavssisalvggamqthytptkagllslmqscaialgpyg
ircnavlpgtiatdinkedlsdlekrermtsrvplgrlgepddlagpivflasdmaryvt
gasllvdgglfvnlq

SCOPe Domain Coordinates for d7do7a1:

Click to download the PDB-style file with coordinates for d7do7a1.
(The format of our PDB-style files is described here.)

Timeline for d7do7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7do7a2