Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Azotobacter vinelandii [TaxId:322710] [398354] (4 PDB entries) |
Domain d7do7a1: 7do7 A:2-256 [398903] Other proteins in same PDB: d7do7a2, d7do7b2 automated match to d4nbua_ complexed with nad, rm4 |
PDB Entry: 7do7 (more details), 1.57 Å
SCOPe Domain Sequences for d7do7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7do7a1 c.2.1.0 (A:2-256) automated matches {Azotobacter vinelandii [TaxId: 322710]} llidktvivtgasrgigraaarecarqgarvvighsgsdegragalslaeeiaafggtai avgadaadldsgeklvaaaveafgsvdvlvnnagicpfhsfldmprelylktvgtnlnga yftvqaaarrmkeqgrggaiiavssisalvggamqthytptkagllslmqscaialgpyg ircnavlpgtiatdinkedlsdlekrermtsrvplgrlgepddlagpivflasdmaryvt gasllvdgglfvnlq
Timeline for d7do7a1: