SCOPe 2.01: Domain d4dbvp2: 4dbv P:149-312

Lineage for d4dbvp2 (4dbv P:149-312)

Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (6 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
Domain d4dbvp2: 4dbv P:149-312 [39890]
Other proteins in same PDB: d4dbvo1, d4dbvp1, d4dbvq1, d4dbvr1
complexed with ndp, so4; mutant

Details for d4dbvp2

PDB Entry: 4dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d4dbvp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbvp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d4dbvp2:

Click to download the PDB-style file with coordinates for d4dbvp2.
(The format of our PDB-style files is described here.)

Timeline for d4dbvp2: