SCOPe 2.02: Domain d2dbvr2: 2dbv R:149-312

Lineage for d2dbvr2 (2dbv R:149-312)

Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (6 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
Domain d2dbvr2: 2dbv R:149-312 [39888]
Other proteins in same PDB: d2dbvo1, d2dbvp1, d2dbvq1, d2dbvr1
complexed with ndp, so4; mutant

Details for d2dbvr2

PDB Entry: 2dbv (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

PDB Compounds: (R:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2dbvr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbvr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d2dbvr2:

Click to download the PDB-style file with coordinates for d2dbvr2.
(The format of our PDB-style files is described here.)

Timeline for d2dbvr2: