| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
| Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries) |
| Domain d2dbvp2: 2dbv P:149-312 [39886] Other proteins in same PDB: d2dbvo1, d2dbvp1, d2dbvq1, d2dbvr1 |
PDB Entry: 2dbv (more details), 2.2 Å
SCOP Domain Sequences for d2dbvp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dbvp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
Timeline for d2dbvp2: