Lineage for d2dbvo2 (2dbv O:149-312)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259192Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 259193Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 259194Family d.81.1.1: GAPDH-like [55348] (2 proteins)
    has many additional secondary structures
  6. 259205Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)
  7. 259214Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)
  8. 259223Domain d2dbvo2: 2dbv O:149-312 [39885]
    Other proteins in same PDB: d2dbvo1, d2dbvp1, d2dbvq1, d2dbvr1

Details for d2dbvo2

PDB Entry: 2dbv (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

SCOP Domain Sequences for d2dbvo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbvo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d2dbvo2:

Click to download the PDB-style file with coordinates for d2dbvo2.
(The format of our PDB-style files is described here.)

Timeline for d2dbvo2: