Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) |
Family d.81.1.1: GAPDH-like [55348] (2 proteins) |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species) |
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries) |
Domain d1dbvr2: 1dbv R:149-312 [39884] Other proteins in same PDB: d1dbvo1, d1dbvp1, d1dbvq1, d1dbvr1 |
PDB Entry: 1dbv (more details), 2.5 Å
SCOP Domain Sequences for d1dbvr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbvr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503} cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
Timeline for d1dbvr2: