Lineage for d1dbvr2 (1dbv R:149-312)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135040Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 135048Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
  7. 135057Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)
  8. 135065Domain d1dbvr2: 1dbv R:149-312 [39884]
    Other proteins in same PDB: d1dbvo1, d1dbvp1, d1dbvq1, d1dbvr1

Details for d1dbvr2

PDB Entry: 1dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

SCOP Domain Sequences for d1dbvr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbvr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d1dbvr2:

Click to download the PDB-style file with coordinates for d1dbvr2.
(The format of our PDB-style files is described here.)

Timeline for d1dbvr2: