Lineage for d1dbvq2 (1dbv Q:149-312)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 506901Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 506941Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 506953Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)
  8. 506980Domain d1dbvq2: 1dbv Q:149-312 [39883]
    Other proteins in same PDB: d1dbvo1, d1dbvp1, d1dbvq1, d1dbvr1

Details for d1dbvq2

PDB Entry: 1dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

SCOP Domain Sequences for d1dbvq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbvq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d1dbvq2:

Click to download the PDB-style file with coordinates for d1dbvq2.
(The format of our PDB-style files is described here.)

Timeline for d1dbvq2: