SCOPe 2.08: Domain d7db1b2: 7db1 B:90-221

Lineage for d7db1b2 (7db1 B:90-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)

8. Domain d7db1b2: 7db1 B:90-221 [398818]
   Other proteins in same PDB: d7db1a1, d7db1b1
   automated match to d3wywa2
   complexed with dc1, dms, gsh

Details for d7db1b2

PDB Entry: 7db1, 1.83 Å

PDB Description: crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in dimedone- and glutathione- bound form

PDB Compounds: (B:) Glutathione S-transferase E14

SCOPe Domain Sequences for d7db1b2:

Sequence; same for both SEQRES and ATOM records:

>d7db1b2 a.45.1.0 (B:90-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qehaermkvlnlllfecsflfrrdsdfmsaivrqgfanvdvahherklteayiimeryle
nsdfmagpqltladlsivttlstvnlmfplsqfprlrrwftamqqldayeancsgleklr
qtmesvgsfqfp

Timeline for d7db1b2:

• d7db1b2 first appeared in SCOPe 2.07