SCOPe 2.07: Domain d7db3a2: 7db3 A:90-226

Lineage for d7db3a2 (7db3 A:90-226)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (16 PDB entries)

8. Domain d7db3a2: 7db3 A:90-226 [398803]
   Other proteins in same PDB: d7db3a1, d7db3b1
   automated match to d3wywa2
   complexed with dms, gsh, h2x

Details for d7db3a2

PDB Entry: 7db3, 1.7 Å

PDB Description: crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp011-bound form

PDB Compounds: (A:) Glutathione S-transferase E14

SCOPe Domain Sequences for d7db3a2:

Sequence; same for both SEQRES and ATOM records:

>d7db3a2 a.45.1.0 (A:90-226) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qehaermkvlnlllfecsflfrrdsdfmsaivrqgfanvdvahherklteayiimeryle
nsdfmagpqltladlsivttlstvnlmfplsqfprlrrwftamqqldayeancsgleklr
qtmesvgsfqfpsssav

Timeline for d7db3a2:

• d7db3a2 is new in SCOPe 2.07-stable
  
• d7db3a2 appears in the current release, SCOPe 2.08