SCOPe 2.07: Domain d7db3a1: 7db3 A:4-89

Lineage for d7db3a1 (7db3 A:4-89)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (17 PDB entries)

8. Domain d7db3a1: 7db3 A:4-89 [398802]
   Other proteins in same PDB: d7db3a2, d7db3b2
   automated match to d3wywa1
   complexed with dms, gsh, h2x

Details for d7db3a1

PDB Entry: 7db3, 1.7 Å

PDB Description: crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp011-bound form

PDB Compounds: (A:) Glutathione S-transferase E14

SCOPe Domain Sequences for d7db3a1:

Sequence; same for both SEQRES and ATOM records:

>d7db3a1 c.47.1.0 (A:4-89) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkpilyydersppvrsclmliklldidvelrfvnlfkgeqfqkdflalnpqhsvptlvhg
dlvltdshailihlaekfdeggslwp

Timeline for d7db3a1:

• d7db3a1 is new in SCOPe 2.07-stable
  
• d7db3a1 appears in the current release, SCOPe 2.08