Lineage for d1gd1o2 (1gd1 O:149-312)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210563Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1210564Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1210565Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1210619Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1210630Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
  8. 1210635Domain d1gd1o2: 1gd1 O:149-312 [39877]
    Other proteins in same PDB: d1gd1o1, d1gd1p1, d1gd1q1, d1gd1r1
    complexed with nad, so4

Details for d1gd1o2

PDB Entry: 1gd1 (more details), 1.8 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution
PDB Compounds: (O:) holo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gd1o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd1o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d1gd1o2:

Click to download the PDB-style file with coordinates for d1gd1o2.
(The format of our PDB-style files is described here.)

Timeline for d1gd1o2: