Lineage for d1gd1o2 (1gd1 O:149-312)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.1: GAPDH-like [55348] (2 proteins) Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species) 
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries) 
Domain d1gd1o2: 1gd1 O:149-312 [39877]
Other proteins in same PDB: d1gd1o1, d1gd1p1, d1gd1q1, d1gd1r1
Details for d1gd1o2
PDB Entry: 1gd1 (more details), 1.8 Å
PDB Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution
SCOP Domain Sequences for d1gd1o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd1o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
SCOP Domain Coordinates for d1gd1o2:
Click to download the PDB-style file with coordinates for d1gd1o2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gd1o2:
View in 3D
