Lineage for d7cz3c_ (7cz3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944343Species Bacillus cereus [TaxId:226900] [398754] (1 PDB entry)
  8. 2944346Domain d7cz3c_: 7cz3 C: [398766]
    automated match to d5eglb_
    complexed with coa

Details for d7cz3c_

PDB Entry: 7cz3 (more details), 2.9 Å

PDB Description: crystal strcuture of acyl-coa thioesterase from bacillus cereus atcc 14579
PDB Compounds: (C:) acyl-CoA hydrolase

SCOPe Domain Sequences for d7cz3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cz3c_ d.38.1.0 (C:) automated matches {Bacillus cereus [TaxId: 226900]}
ekkfmreskaikttrvfpndlnnhqtlfggkllaeidsiasiaaarhsrkhcvtasidsv
dfltpihqadsvcyeafvcytgkssmevfvkviaenllagerriaatcfitfvaikdgkp
ssvpqvlpetqeehwlhktgleraenrkkgrlkskemaevltlskpwn

SCOPe Domain Coordinates for d7cz3c_:

Click to download the PDB-style file with coordinates for d7cz3c_.
(The format of our PDB-style files is described here.)

Timeline for d7cz3c_: