Lineage for d1dc4b2 (1dc4 B:149-312)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135040Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 135048Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
  7. 135082Species Escherichia coli [TaxId:562] [55350] (6 PDB entries)
  8. 135094Domain d1dc4b2: 1dc4 B:149-312 [39876]
    Other proteins in same PDB: d1dc4a1, d1dc4b1

Details for d1dc4b2

PDB Entry: 1dc4 (more details), 2.5 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes

SCOP Domain Sequences for d1dc4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc4b2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOP Domain Coordinates for d1dc4b2:

Click to download the PDB-style file with coordinates for d1dc4b2.
(The format of our PDB-style files is described here.)

Timeline for d1dc4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc4b1