Lineage for d7d59l_ (7d59 L:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641934Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 2641990Family g.41.9.0: automated matches [191622] (1 protein)
    not a true family
  6. 2641991Protein automated matches [191140] (4 species)
    not a true protein
  7. 2641992Species Homo sapiens [TaxId:9606] [398751] (1 PDB entry)
  8. 2641993Domain d7d59l_: 7d59 L: [398752]
    Other proteins in same PDB: d7d59h_, d7d59j_, d7d59k_
    automated match to d1twfl_
    complexed with sf4, zn

Details for d7d59l_

PDB Entry: 7d59 (more details), 3.1 Å

PDB Description: cryo-em structure of human rna polymerase iii in apo state
PDB Compounds: (L:) DNA-directed RNA polymerases I, II, and III subunit RPABC4

SCOPe Domain Sequences for d7d59l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d59l_ g.41.9.0 (L:) automated matches {Homo sapiens [TaxId: 9606]}
qqpmiyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar

SCOPe Domain Coordinates for d7d59l_:

Click to download the PDB-style file with coordinates for d7d59l_.
(The format of our PDB-style files is described here.)

Timeline for d7d59l_: