Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) |
Family g.41.9.0: automated matches [191622] (1 protein) not a true family |
Protein automated matches [191140] (4 species) not a true protein |
Species Homo sapiens [TaxId:9606] [398751] (1 PDB entry) |
Domain d7d59l_: 7d59 L: [398752] Other proteins in same PDB: d7d59h_, d7d59j_, d7d59k_ automated match to d1twfl_ complexed with sf4, zn |
PDB Entry: 7d59 (more details), 3.1 Å
SCOPe Domain Sequences for d7d59l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d59l_ g.41.9.0 (L:) automated matches {Homo sapiens [TaxId: 9606]} qqpmiyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar
Timeline for d7d59l_: