Lineage for d1dc4a2 (1dc4 A:149-312)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866363Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 866417Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 866486Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
    Uniprot P06977
  8. 866504Domain d1dc4a2: 1dc4 A:149-312 [39875]
    Other proteins in same PDB: d1dc4a1, d1dc4b1

Details for d1dc4a2

PDB Entry: 1dc4 (more details), 2.5 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes
PDB Compounds: (A:) glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1dc4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOP Domain Coordinates for d1dc4a2:

Click to download the PDB-style file with coordinates for d1dc4a2.
(The format of our PDB-style files is described here.)

Timeline for d1dc4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc4a1