Lineage for d1dc3a2 (1dc3 A:149-312)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33809Species Escherichia coli [TaxId:562] [55350] (6 PDB entries)
  8. 33818Domain d1dc3a2: 1dc3 A:149-312 [39873]
    Other proteins in same PDB: d1dc3a1, d1dc3b1

Details for d1dc3a2

PDB Entry: 1dc3 (more details), 2.5 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes

SCOP Domain Sequences for d1dc3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc3a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOP Domain Coordinates for d1dc3a2:

Click to download the PDB-style file with coordinates for d1dc3a2.
(The format of our PDB-style files is described here.)

Timeline for d1dc3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc3a1