SCOPe 2.08: Domain d7ctsa1: 7cts A:47-304

Lineage for d7ctsa1 (7cts A:47-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.16: Lipase [53555] (2 proteins)

6. Protein automated matches [254730] (4 species)
   not a true protein

7. Species Saccharomonospora viridis [TaxId:1852] [269028] (11 PDB entries)

8. Domain d7ctsa1: 7cts A:47-304 [398724]
   Other proteins in same PDB: d7ctsa2, d7ctsa3
   automated match to d4wfia_
   complexed with bcn, ca, dio; mutant

Details for d7ctsa1

PDB Entry: 7cts, 1.1 Å

PDB Description: open form of pet-degrading cutinase cut190 with thermostability- improving mutations of s226p/r228s/q138a/d250c-e296c/q123h/n202h and s176a inactivation

PDB Compounds: (A:) Alpha/beta hydrolase family protein

SCOPe Domain Sequences for d7ctsa1:

Sequence; same for both SEQRES and ATOM records:

>d7ctsa1 c.69.1.16 (A:47-304) automated matches {Saccharomonospora viridis [TaxId: 1852]}
npyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavavapgf
tasqgsmswygervashgfivftidtntrldapgqrgrqllaaldylversdrkvrerld
pnrlavmghamggggsleatvmrpslkasipltpwhldktwgqvqvptfiigaeldtiap
vsthakpfyeslpsslpkaymelcgathfapnipnttiakyviswlkrfvdedtrysqfl
cpnptdraiceyrstcpy

Timeline for d7ctsa1:

• d7ctsa1 first appeared in SCOPe 2.07