SCOP 1.67: Domain d1gaep2: 1gae P:149-312

Lineage for d1gaep2 (1gae P:149-312)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (3 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)

7. Species Escherichia coli [TaxId:562] [55350] (6 PDB entries)

8. Domain d1gaep2: 1gae P:149-312 [39870]
   Other proteins in same PDB: d1gaeo1, d1gaep1
   complexed with nad; mutant

Details for d1gaep2

PDB Entry: 1gae, 2.17 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity

SCOP Domain Sequences for d1gaep2:

Sequence; same for both SEQRES and ATOM records:

>d1gaep2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

Timeline for d1gaep2:

• d1gaep2 first appeared (with stable ids) in SCOP 1.55
  
• d1gaep2 appears in SCOP 1.65
  
• d1gaep2 appears in SCOP 1.69
  
• d1gaep2 appears in the current release, SCOPe 2.08