Lineage for d1gaeo2 (1gae O:149-312)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210563Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1210564Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1210565Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1210619Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1210675Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
    Uniprot P06977
  8. 1210684Domain d1gaeo2: 1gae O:149-312 [39869]
    Other proteins in same PDB: d1gaeo1, d1gaep1
    complexed with nad; mutant

Details for d1gaeo2

PDB Entry: 1gae (more details), 2.17 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity
PDB Compounds: (O:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gaeo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaeo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOPe Domain Coordinates for d1gaeo2:

Click to download the PDB-style file with coordinates for d1gaeo2.
(The format of our PDB-style files is described here.)

Timeline for d1gaeo2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gaeo1