![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species) |
![]() | Species Escherichia coli [TaxId:562] [55350] (12 PDB entries) Uniprot P06977 |
![]() | Domain d1dc5a2: 1dc5 A:149-312 [39867] Other proteins in same PDB: d1dc5a1, d1dc5b1 |
PDB Entry: 1dc5 (more details), 2 Å
SCOPe Domain Sequences for d1dc5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dc5a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd
Timeline for d1dc5a2: