SCOPe 2.05: Domain d1gado2: 1gad O:149-312

Lineage for d1gado2 (1gad O:149-312)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
   Uniprot P06977

8. Domain d1gado2: 1gad O:149-312 [39865]
   Other proteins in same PDB: d1gado1, d1gadp1
   complexed with nad; mutant

Details for d1gado2

PDB Entry: 1gad, 1.8 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity

PDB Compounds: (O:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gado2:

Sequence; same for both SEQRES and ATOM records:

>d1gado2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

Timeline for d1gado2:

• d1gado2 first appeared (with stable ids) in SCOP 1.55
  
• d1gado2 appears in SCOPe 2.04
  
• d1gado2 appears in SCOPe 2.06
  
• d1gado2 appears in the current release, SCOPe 2.08