SCOPe 2.07: Domain d7c523_: 7c52 3:

Lineage for d7c523_ (7c52 3:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (7 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)

8. Domain d7c523_: 7c52 3: [398640]
   Other proteins in same PDB: d7c52b_, d7c52c_, d7c52h1, d7c52h2, d7c52m_
   automated match to d3wmm1_
   complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lhg, lmt, mq8, pef, pgv, sf4, so4, uq8

Details for d7c523_

PDB Entry: 7c52, 2.89 Å

PDB Description: co-crystal structure of a photosynthetic lh1-rc in complex with electron donor hipip

PDB Compounds: (3:) LH1 alpha polypeptide

SCOPe Domain Sequences for d7c523_:

Sequence; same for both SEQRES and ATOM records:

>d7c523_ f.3.1.0 (3:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
mnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg

Timeline for d7c523_:

• d7c523_ is new in SCOPe 2.07-stable
  
• d7c523_ appears in the current release, SCOPe 2.08