Lineage for d1dptb_ (1dpt B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33714Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 33715Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 33737Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 33738Protein D-dopachrome tautomerase [55344] (1 species)
  7. 33739Species Human (Homo sapiens) [TaxId:9606] [55345] (1 PDB entry)
  8. 33741Domain d1dptb_: 1dpt B: [39863]

Details for d1dptb_

PDB Entry: 1dpt (more details), 1.54 Å

PDB Description: d-dopachrome tautomerase

SCOP Domain Sequences for d1dptb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dptb_ d.80.1.3 (B:) D-dopachrome tautomerase {Human (Homo sapiens)}
pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl

SCOP Domain Coordinates for d1dptb_:

Click to download the PDB-style file with coordinates for d1dptb_.
(The format of our PDB-style files is described here.)

Timeline for d1dptb_: