Lineage for d1dptb_ (1dpt B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526662Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2526663Protein D-dopachrome tautomerase [55344] (2 species)
  7. 2526664Species Human (Homo sapiens) [TaxId:9606] [55345] (4 PDB entries)
  8. 2526669Domain d1dptb_: 1dpt B: [39863]
    CASP3

Details for d1dptb_

PDB Entry: 1dpt (more details), 1.54 Å

PDB Description: d-dopachrome tautomerase
PDB Compounds: (B:) D-dopachrome tautomerase

SCOPe Domain Sequences for d1dptb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dptb_ d.80.1.3 (B:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]}
pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl

SCOPe Domain Coordinates for d1dptb_:

Click to download the PDB-style file with coordinates for d1dptb_.
(The format of our PDB-style files is described here.)

Timeline for d1dptb_: