Lineage for d1dpta_ (1dpt A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. Protein D-dopachrome tautomerase [55344] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55345] (4 PDB entries)
  8. Domain d1dpta_: 1dpt A: [39862]
    CASP3

Details for d1dpta_

PDB Entry: 1dpt (more details), 1.54 Å

PDB Description: d-dopachrome tautomerase
PDB Compounds: (A:) D-dopachrome tautomerase

SCOPe Domain Sequences for d1dpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]}
pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl

SCOPe Domain Coordinates for d1dpta_ are not available.

Timeline for d1dpta_:

Domains from other chains:
(mouse over for more information)
d1dptb_, d1dptc_