SCOPe 2.07: Domain d7bupc1: 7bup C:1-122

Lineage for d7bupc1 (7bup C:1-122)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [398593] (1 PDB entry)

8. Domain d7bupc1: 7bup C:1-122 [398605]
   automated match to d1plqa1

Details for d7bupc1

PDB Entry: 7bup, 2.7 Å

PDB Description: crystal structure of pcna from pathogenic yeast candida albicans

PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d7bupc1:

Sequence; same for both SEQRES and ATOM records:

>d7bupc1 d.131.1.0 (C:1-122) automated matches {Candida albicans [TaxId: 237561]}
mlegkfeeaallkkvveaikdcvkkcnfncsehgitvqavddsrvllvslligqtsfsey
rcdrdvtlgidlesfskiiksannedfltllaedspdqimaileekqkekiseyslklmd
id

Timeline for d7bupc1:

• d7bupc1 is new in SCOPe 2.07-stable
  
• d7bupc1 appears in the current release, SCOPe 2.08