Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (7 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries) |
Domain d7c52n_: 7c52 N: [398580] Other proteins in same PDB: d7c52b_, d7c52c_, d7c52h1, d7c52h2, d7c52m_ automated match to d1wrga_ complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lhg, lmt, mq8, pef, pgv, sf4, so4, uq8 |
PDB Entry: 7c52 (more details), 2.89 Å
SCOPe Domain Sequences for d7c52n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c52n_ f.3.1.0 (N:) automated matches {Thermochromatium tepidum [TaxId: 1050]} sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
Timeline for d7c52n_:
View in 3D Domains from other chains: (mouse over for more information) d7c520_, d7c521_, d7c522_, d7c523_, d7c524_, d7c525_, d7c526_, d7c527_, d7c528_, d7c529_, d7c52a_, d7c52b_, d7c52c_, d7c52d_, d7c52e_, d7c52f_, d7c52g_, d7c52h1, d7c52h2, d7c52i_, d7c52j_, d7c52k_, d7c52m_, d7c52o_, d7c52p_, d7c52q_, d7c52r_, d7c52s_, d7c52t_, d7c52u_, d7c52v_, d7c52w_, d7c52x_, d7c52y_, d7c52z_ |