Lineage for d1mfic_ (1mfi C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727709Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 727710Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) (S)
  5. 727795Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 727801Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 727841Species Mouse (Mus musculus) [TaxId:10090] [55343] (3 PDB entries)
  8. 727847Domain d1mfic_: 1mfi C: [39858]
    complexed with fhc

Details for d1mfic_

PDB Entry: 1mfi (more details), 1.8 Å

PDB Description: crystal structure of macrophage migration inhibitory factor complexed with (e)-2-fluoro-p-hydroxycinnamate
PDB Compounds: (C:) protein (macrophage migration inhibitory factor)

SCOP Domain Sequences for d1mfic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfic_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]}
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa

SCOP Domain Coordinates for d1mfic_:

Click to download the PDB-style file with coordinates for d1mfic_.
(The format of our PDB-style files is described here.)

Timeline for d1mfic_: