Lineage for d7c528_ (7c52 8:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627145Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2627146Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2627209Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 2627210Protein automated matches [254444] (7 species)
    not a true protein
  7. 2627308Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)
  8. 2627349Domain d7c528_: 7c52 8: [398575]
    Other proteins in same PDB: d7c52b_, d7c52c_, d7c52h1, d7c52h2, d7c52m_
    automated match to d1wrga_
    complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lhg, lmt, mq8, pef, pgv, sf4, so4, uq8

Details for d7c528_

PDB Entry: 7c52 (more details), 2.89 Å

PDB Description: co-crystal structure of a photosynthetic lh1-rc in complex with electron donor hipip
PDB Compounds: (8:) LH1 beta polypeptide

SCOPe Domain Sequences for d7c528_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c528_ f.3.1.0 (8:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
ltgltddeakefhaifmqsmyawfglvviahllawlyrpwl

SCOPe Domain Coordinates for d7c528_:

Click to download the PDB-style file with coordinates for d7c528_.
(The format of our PDB-style files is described here.)

Timeline for d7c528_: