Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (28 species) not a true protein |
Species Mus musculus [TaxId:10090] [394118] (4 PDB entries) |
Domain d7ak5u_: 7ak5 U: [398572] Other proteins in same PDB: d7ak5f1, d7ak5f2, d7ak5f3 automated match to d2qnwa_ complexed with 3pe, atp, cdl, ehz, fes, fmn, ndp, pc1, sf4, zn |
PDB Entry: 7ak5 (more details), 3.17 Å
SCOPe Domain Sequences for d7ak5u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ak5u_ a.28.1.0 (U:) automated matches {Mus musculus [TaxId: 10090]} sdappltldgikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf eipdidaeklmcpqeivdyiadkkdvye
Timeline for d7ak5u_:
View in 3D Domains from other chains: (mouse over for more information) d7ak5f1, d7ak5f2, d7ak5f3, d7ak5t_ |