Lineage for d1fim__ (1fim -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134931Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 134932Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 134993Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 134999Protein Microphage migration inhibition factor (MIF) [55340] (4 species)
  7. 135029Species Rat (Rattus norvegicus) [TaxId:10116] [55342] (1 PDB entry)
  8. 135030Domain d1fim__: 1fim - [39855]

Details for d1fim__

PDB Entry: 1fim (more details), 2.2 Å

PDB Description: macrophage migration inhibitory factor

SCOP Domain Sequences for d1fim__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fim__ d.80.1.3 (-) Microphage migration inhibition factor (MIF) {Rat (Rattus norvegicus)}
pafivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtsdpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydana

SCOP Domain Coordinates for d1fim__:

Click to download the PDB-style file with coordinates for d1fim__.
(The format of our PDB-style files is described here.)

Timeline for d1fim__: