Lineage for d1fim__ (1fim -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) 
Family d.80.1.3: MIF-related [55339] (2 proteins) Protein Microphage migration inhibition factor (MIF) [55340] (3 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [55342] (1 PDB entry) 
Domain d1fim__: 1fim - [39855]
Details for d1fim__
PDB Entry: 1fim (more details), 2.2 Å
PDB Description: macrophage migration inhibitory factor
SCOP Domain Sequences for d1fim__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fim__ d.80.1.3 (-) Microphage migration inhibition factor (MIF) {Rat (Rattus norvegicus)}
pafivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtsdpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydana
SCOP Domain Coordinates for d1fim__:
Click to download the PDB-style file with coordinates for d1fim__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fim__:
- d1fim__ appears in SCOP 1.57
- d1fim__ appears in the current release, SCOPe 2.08, called d1fima_
View in 3D