Lineage for d1mifc_ (1mif C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81513Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 81514Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 81575Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 81581Protein Microphage migration inhibition factor (MIF) [55340] (4 species)
  7. 81582Species Human (Homo sapiens) [TaxId:9606] [55341] (7 PDB entries)
  8. 81600Domain d1mifc_: 1mif C: [39854]

Details for d1mifc_

PDB Entry: 1mif (more details), 2.6 Å

PDB Description: macrophage migration inhibitory factor (mif)

SCOP Domain Sequences for d1mifc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mifc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaasvgwnnstfa

SCOP Domain Coordinates for d1mifc_:

Click to download the PDB-style file with coordinates for d1mifc_.
(The format of our PDB-style files is described here.)

Timeline for d1mifc_: