Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) |
Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) |
Family d.80.1.3: MIF-related [55339] (2 proteins) |
Protein Microphage migration inhibition factor (MIF) [55340] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [55341] (7 PDB entries) |
Domain d1mifc_: 1mif C: [39854] |
PDB Entry: 1mif (more details), 2.6 Å
SCOP Domain Sequences for d1mifc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mifc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)} pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaasvgwnnstfa
Timeline for d1mifc_: