Lineage for d7bh9e_ (7bh9 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616541Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries)
  8. 2616632Domain d7bh9e_: 7bh9 E: [398521]
    Other proteins in same PDB: d7bh9a_
    automated match to d2dd8s1
    complexed with nag, zn

Details for d7bh9e_

PDB Entry: 7bh9 (more details), 2.9 Å

PDB Description: sars-cov-2 rbd-62 in complex with ace2 peptidase domain
PDB Compounds: (E:) Spike protein S1

SCOPe Domain Sequences for d7bh9e_:

Sequence, based on SEQRES records: (download)

>d7bh9e_ d.318.1.1 (E:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
vfnatrfasvyawnrkrfsncvadysvlynsasfstfkcygvsptklndlcftnvyadsf
virgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskkggnynylyrlfrksk
lkpferdtsmeiyqagntpcngvkgfncyfplqsygfrptygvgyqpyrvvvls

Sequence, based on observed residues (ATOM records): (download)

>d7bh9e_ d.318.1.1 (E:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
vfnatrfasvyawnrkasfstfkcyyadsfvirgdevrqiapgqtgkiadynyklpddft
gcviawnsnnldskkggnynylyrlfrksklkpferdtsmeiyqagntpcngvkgfncyf
plqsygfrptygvgyqpyrvvvls

SCOPe Domain Coordinates for d7bh9e_:

Click to download the PDB-style file with coordinates for d7bh9e_.
(The format of our PDB-style files is described here.)

Timeline for d7bh9e_: