Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7benb1: 7ben B:1-106 [398514] Other proteins in same PDB: d7bena_, d7benb2, d7benc_, d7bene_, d7benf1, d7benf2, d7beng_, d7beni2, d7benl1, d7benl2 automated match to d1dn0a1 complexed with br, fuc, gol, imd, iod, nag, peg, pg6 |
PDB Entry: 7ben (more details), 2.5 Å
SCOPe Domain Sequences for d7benb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7benb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqltqspssvsasvgdrvtitcrasqgisswlawyqqkpgkapklliyavsslqsgvps rfsgsgsgtdftltisslqpedfatyycqqaksfpftfgpgtkvei
Timeline for d7benb1: