SCOPe 2.05: Domain d1p1gc_: 1p1g C:

Lineage for d1p1gc_ (1p1g C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)
   automatically mapped to Pfam PF01187

6. Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (59 PDB entries)

8. Domain d1p1gc_: 1p1g C: [39851]

Details for d1p1gc_

PDB Entry: 1p1g, 2.5 Å

PDB Description: macrophage migration inhibitory factor (mif) with pro-1 mutated to gly-1

PDB Compounds: (C:) protein (macrophage migration inhibitory factor)

SCOPe Domain Sequences for d1p1gc_:

Sequence; same for both SEQRES and ATOM records:

>d1p1gc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
gmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d1p1gc_:

• d1p1gc_ first appeared (with stable ids) in SCOP 1.55
  
• d1p1gc_ appears in SCOPe 2.04
  
• d1p1gc_ appears in SCOPe 2.06
  
• d1p1gc_ appears in the current release, SCOPe 2.08