Lineage for d1p1gb_ (1p1g B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134931Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 134932Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 134993Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 134999Protein Microphage migration inhibition factor (MIF) [55340] (4 species)
  7. 135000Species Human (Homo sapiens) [TaxId:9606] [55341] (7 PDB entries)
  8. 135020Domain d1p1gb_: 1p1g B: [39850]

Details for d1p1gb_

PDB Entry: 1p1g (more details), 2.5 Å

PDB Description: macrophage migration inhibitory factor (mif) with pro-1 mutated to gly-1

SCOP Domain Sequences for d1p1gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1gb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)}
gmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOP Domain Coordinates for d1p1gb_:

Click to download the PDB-style file with coordinates for d1p1gb_.
(The format of our PDB-style files is described here.)

Timeline for d1p1gb_: