SCOPe 2.08: Domain d7by4a1: 7by4 A:875-1110

Lineage for d7by4a1 (7by4 A:875-1110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein automated matches [229097] (6 species)
   not a true protein

7. Species Clostridium tetani [TaxId:212717] [398498] (1 PDB entry)

8. Domain d7by4a1: 7by4 A:875-1110 [398499]
   Other proteins in same PDB: d7by4a2
   automated match to d1a8da1
   complexed with btb, cso, gol, na

Details for d7by4a1

PDB Entry: 7by4, 1.5 Å

PDB Description: tetanus neurotoxin receptor binding domain

PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d7by4a1:

Sequence; same for both SEQRES and ATOM records:

>d7by4a1 b.29.1.6 (A:875-1110) automated matches {Clostridium tetani [TaxId: 212717]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

Timeline for d7by4a1:

• d7by4a1 first appeared in SCOPe 2.07