Lineage for d7brsc3 (7brs C:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441316Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries)
  8. 2441344Domain d7brsc3: 7brs C:334-625 [398495]
    Other proteins in same PDB: d7brsa1, d7brsa2, d7brsa4, d7brsa5, d7brsb1, d7brsb2, d7brsb4, d7brsb5, d7brsc1, d7brsc2, d7brsc4, d7brsc5, d7brsd1, d7brsd2, d7brsd4, d7brsd5
    automated match to d1jz7a5
    complexed with dms, f4x, gol, mg, na

Details for d7brsc3

PDB Entry: 7brs (more details), 2.67 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d7brsc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7brsc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d7brsc3:

Click to download the PDB-style file with coordinates for d7brsc3.
(The format of our PDB-style files is described here.)

Timeline for d7brsc3: