Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries) |
Domain d7brsc3: 7brs C:334-625 [398495] Other proteins in same PDB: d7brsa1, d7brsa2, d7brsa4, d7brsa5, d7brsb1, d7brsb2, d7brsb4, d7brsb5, d7brsc1, d7brsc2, d7brsc4, d7brsc5, d7brsd1, d7brsd2, d7brsd4, d7brsd5 automated match to d1jz7a5 complexed with dms, f4x, gol, mg, na |
PDB Entry: 7brs (more details), 2.67 Å
SCOPe Domain Sequences for d7brsc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7brsc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d7brsc3:
View in 3D Domains from same chain: (mouse over for more information) d7brsc1, d7brsc2, d7brsc4, d7brsc5 |