Lineage for d7brsd1 (7brs D:3-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384872Domain d7brsd1: 7brs D:3-219 [398480]
    Other proteins in same PDB: d7brsa2, d7brsa3, d7brsa4, d7brsa5, d7brsb2, d7brsb3, d7brsb4, d7brsb5, d7brsc2, d7brsc3, d7brsc4, d7brsc5, d7brsd2, d7brsd3, d7brsd4, d7brsd5
    automated match to d1f4ha3
    complexed with dms, f4x, gol, mg, na

Details for d7brsd1

PDB Entry: 7brs (more details), 2.67 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d7brsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7brsd1 b.18.1.0 (D:3-219) automated matches {Escherichia coli [TaxId: 83333]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d7brsd1:

Click to download the PDB-style file with coordinates for d7brsd1.
(The format of our PDB-style files is described here.)

Timeline for d7brsd1: