![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (49 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
![]() | Domain d7brsd1: 7brs D:3-219 [398480] Other proteins in same PDB: d7brsa2, d7brsa3, d7brsa4, d7brsa5, d7brsb2, d7brsb3, d7brsb4, d7brsb5, d7brsc2, d7brsc3, d7brsc4, d7brsc5, d7brsd2, d7brsd3, d7brsd4, d7brsd5 automated match to d1f4ha3 complexed with dms, f4x, gol, mg, na |
PDB Entry: 7brs (more details), 2.67 Å
SCOPe Domain Sequences for d7brsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7brsd1 b.18.1.0 (D:3-219) automated matches {Escherichia coli [TaxId: 83333]} itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d7brsd1:
![]() Domains from same chain: (mouse over for more information) d7brsd2, d7brsd3, d7brsd4, d7brsd5 |