![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) ![]() |
![]() | Family d.80.1.3: MIF-related [55339] (2 proteins) |
![]() | Protein Microphage migration inhibition factor (MIF) [55340] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55341] (7 PDB entries) |
![]() | Domain d1ca7b_: 1ca7 B: [39847] |
PDB Entry: 1ca7 (more details), 2.5 Å
SCOP Domain Sequences for d1ca7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca7b_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)} pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d1ca7b_: