Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d7bepi1: 7bep I:1-106 [398461] Other proteins in same PDB: d7bepc1, d7bepc2, d7bepe1, d7bepe2, d7bepi2, d7bepl2 automated match to d1dn0a1 complexed with cl, glu, gly, gol, imd, peg, pg4, pge |
PDB Entry: 7bep (more details), 2.61 Å
SCOPe Domain Sequences for d7bepi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bepi1 b.1.1.1 (I:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspgtlslspgeratlscrasqtvsstslawyqqkpgqaprlliygassratgip drfsgsgsgtdftltisrlepedfavyycqqhdtsltfgggtkvei
Timeline for d7bepi1: