Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d7beni2: 7ben I:107-213 [398439] Other proteins in same PDB: d7benb1, d7benc_, d7bene_, d7benf1, d7beni1, d7benl1 automated match to d1dn0a2 complexed with br, fuc, gol, imd, iod, nag, peg, pg6 |
PDB Entry: 7ben (more details), 2.5 Å
SCOPe Domain Sequences for d7beni2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7beni2 b.1.1.2 (I:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d7beni2: