SCOPe 2.07: Domain d7bbdc1: 7bbd C:1-152

Lineage for d7bbdc1 (7bbd C:1-152)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d7bbdc1: 7bbd C:1-152 [398433]
   Other proteins in same PDB: d7bbda2, d7bbdc2, d7bbdd_
   automated match to d2c2vb_
   complexed with zn

Details for d7bbdc1

PDB Entry: 7bbd, 2.2 Å

PDB Description: crystal structure of monoubiquitinated trim21 ring (ub-ring) in complex with ubiquitin charged ube2n (ube2n~ub) and ube2v2

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d7bbdc1:

Sequence; same for both SEQRES and ATOM records:

>d7bbdc1 d.20.1.1 (C:1-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
eypmaapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddp
landvaeqwktneaqaietarawtrlyamnni

Timeline for d7bbdc1:

• d7bbdc1 is new in SCOPe 2.07-stable
  
• d7bbdc1 appears in the current release, SCOPe 2.08